SCOPe 2.07: Domain d4x2ab_: 4x2a B:

Lineage for d4x2ab_ (4x2a B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold

6. Protein automated matches [190953] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188562] (7 PDB entries)

8. Domain d4x2ab_: 4x2a B: [277016]
   automated match to d1qipb_
   complexed with 3wl, zn

Details for d4x2ab_

PDB Entry: 4x2a, 2 Å

PDB Description: crystal structure of mouse glyoxalase i complexed with baicalein

PDB Compounds: (B:) lactoylglutathione lyase

SCOPe Domain Sequences for d4x2ab_:

Sequence, based on SEQRES records:

>d4x2ab_ d.32.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ssgltdetafsccsdpdpstkdfllqqtmlrikdpkksldfytrvlgltllqkldfpamk
fslyflayedkndipkdksektawtfsrkatlelthnwgteddetqsyhngnsdprgfgh
igiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkiati

Sequence, based on observed residues (ATOM records):

>d4x2ab_ d.32.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ssgltdetafsccsdpdpstkdfllqqtmlrikdpkksldfytrvlgltllqkldfpamk
fslyflayedkndipkdksektawtfsrkatlelthnwgteddetqsyhngnsdprgfgh
igiavpdvysackrfeelgvkfvkkpddgmkglafiqdpdgywieilnpnkiati

Timeline for d4x2ab_:

• d4x2ab_ first appeared in SCOPe 2.05
  
• d4x2ab_ appears in SCOPe 2.06
  
• d4x2ab_ appears in the current release, SCOPe 2.08