Lineage for d1qipb_ (1qip B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549435Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
  6. 2549436Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species)
  7. 2549448Species Human (Homo sapiens) [TaxId:9606] [54596] (4 PDB entries)
  8. 2549450Domain d1qipb_: 1qip B: [38471]
    complexed with bme, gnb, zn

Details for d1qipb_

PDB Entry: 1qip (more details), 1.72 Å

PDB Description: human glyoxalase i complexed with s-p-nitrobenzyloxycarbonylglutathione
PDB Compounds: (B:) protein (lactoylglutathione lyase)

SCOPe Domain Sequences for d1qipb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qipb_ d.32.1.1 (B:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]}
aepqppsggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkc
dfpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsd
prgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkma
tlm

SCOPe Domain Coordinates for d1qipb_:

Click to download the PDB-style file with coordinates for d1qipb_.
(The format of our PDB-style files is described here.)

Timeline for d1qipb_: