Lineage for d3wr7d_ (3wr7 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575664Species Escherichia coli [TaxId:83333] [260781] (4 PDB entries)
  8. 2575669Domain d3wr7d_: 3wr7 D: [276607]
    automated match to d4r9mc_
    complexed with coa, spd

Details for d3wr7d_

PDB Entry: 3wr7 (more details), 2.5 Å

PDB Description: crystal structure of spermidine acetyltransferase from escherichia coli
PDB Compounds: (D:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d3wr7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wr7d_ d.108.1.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
hsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrfvvec
dgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklyliv
dkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylaehk

SCOPe Domain Coordinates for d3wr7d_:

Click to download the PDB-style file with coordinates for d3wr7d_.
(The format of our PDB-style files is described here.)

Timeline for d3wr7d_: