SCOPe 2.07: Domain d3wr7a_: 3wr7 A:

Lineage for d3wr7a_ (3wr7 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [260781] (4 PDB entries)

8. Domain d3wr7a_: 3wr7 A: [276605]
   automated match to d4r9mc_
   complexed with coa, spd

Details for d3wr7a_

PDB Entry: 3wr7, 2.5 Å

PDB Description: crystal structure of spermidine acetyltransferase from escherichia coli

PDB Compounds: (A:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d3wr7a_:

Sequence; same for both SEQRES and ATOM records:

>d3wr7a_ d.108.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
hsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrfvvec
dgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklyliv
dkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylaehk

Timeline for d3wr7a_:

• d3wr7a_ first appeared in SCOPe 2.05
  
• d3wr7a_ appears in SCOPe 2.06
  
• d3wr7a_ appears in the current release, SCOPe 2.08