Lineage for d4uinl2 (4uin L:108-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364352Domain d4uinl2: 4uin L:108-214 [276586]
    Other proteins in same PDB: d4uinl1
    automated match to d2v7ha2
    complexed with qi9

Details for d4uinl2

PDB Entry: 4uin (more details), 2.5 Å

PDB Description: crystal structure of quinine-dependent fab 314.3 with quinine
PDB Compounds: (L:) fab 314.3

SCOPe Domain Sequences for d4uinl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uinl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d4uinl2:

Click to download the PDB-style file with coordinates for d4uinl2.
(The format of our PDB-style files is described here.)

Timeline for d4uinl2: