Lineage for d5d9ub2 (5d9u B:137-304)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216893Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2216894Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2216968Family d.139.1.0: automated matches [227182] (1 protein)
    not a true family
  6. 2216969Protein automated matches [226902] (11 species)
    not a true protein
  7. 2216970Species Acinetobacter baumannii [TaxId:470] [276304] (3 PDB entries)
  8. 2216976Domain d5d9ub2: 5d9u B:137-304 [276561]
    Other proteins in same PDB: d5d9ua1, d5d9ub1
    automated match to d3mcqa2
    complexed with adp, mg, na, tpp

Details for d5d9ub2

PDB Entry: 5d9u (more details), 1.9 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form
PDB Compounds: (B:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5d9ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d9ub2 d.139.1.0 (B:137-304) automated matches {Acinetobacter baumannii [TaxId: 470]}
tgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptprcklgeelkglassm
idvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwqyalaggddyelcfti
tpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgyqhf

SCOPe Domain Coordinates for d5d9ub2:

Click to download the PDB-style file with coordinates for d5d9ub2.
(The format of our PDB-style files is described here.)

Timeline for d5d9ub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d9ub1