SCOPe 2.06: Domain d5d9ub2: 5d9u B:137-304

Lineage for d5d9ub2 (5d9u B:137-304)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (11 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [276304] (3 PDB entries)

8. Domain d5d9ub2: 5d9u B:137-304 [276561]
   Other proteins in same PDB: d5d9ua1, d5d9ub1
   automated match to d3mcqa2
   complexed with adp, mg, na, tpp

Details for d5d9ub2

PDB Entry: 5d9u, 1.9 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form

PDB Compounds: (B:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5d9ub2:

Sequence; same for both SEQRES and ATOM records:

>d5d9ub2 d.139.1.0 (B:137-304) automated matches {Acinetobacter baumannii [TaxId: 470]}
tgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptprcklgeelkglassm
idvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwqyalaggddyelcfti
tpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgyqhf

Timeline for d5d9ub2:

• d5d9ub2 first appeared in SCOPe 2.05
  
• d5d9ub2 appears in SCOPe 2.07
  
• d5d9ub2 appears in the current release, SCOPe 2.08