Lineage for d3mcqa2 (3mcq A:136-308)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216893Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2216894Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2216968Family d.139.1.0: automated matches [227182] (1 protein)
    not a true family
  6. 2216969Protein automated matches [226902] (11 species)
    not a true protein
  7. 2216994Species Methylobacillus flagellatus [TaxId:265072] [225899] (1 PDB entry)
  8. 2216995Domain d3mcqa2: 3mcq A:136-308 [213205]
    Other proteins in same PDB: d3mcqa1
    automated match to d3c9ua2
    complexed with 1pe, na, peg, pg4, pge

Details for d3mcqa2

PDB Entry: 3mcq (more details), 1.91 Å

PDB Description: crystal structure of thiamine-monophosphate kinase (mfla_0573) from methylobacillus flagellatus kt at 1.91 a resolution
PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d3mcqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mcqa2 d.139.1.0 (A:136-308) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
pgasllrstaradddiwvsgplgdaalalaaiqgryplsdtelaacgkalhqpqprvvlg
qalrglahsaldisdglladlghilehsqvgaevwlkaipksevvsahsqevaiqkmils
ggddyelcftastqhrqqiadigrqlsldmavigritdtqqlvihglddaplt

SCOPe Domain Coordinates for d3mcqa2:

Click to download the PDB-style file with coordinates for d3mcqa2.
(The format of our PDB-style files is described here.)

Timeline for d3mcqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mcqa1