Class b: All beta proteins [48724] (178 folds) |
Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) |
Family b.78.1.0: automated matches [191418] (1 protein) not a true family |
Protein automated matches [190587] (7 species) not a true protein |
Species Colocasia esculenta [TaxId:4460] [276542] (5 PDB entries) |
Domain d5d5gd_: 5d5g D: [276544] automated match to d3r0eb_ complexed with epe, mg, so4 |
PDB Entry: 5d5g (more details), 1.74 Å
SCOPe Domain Sequences for d5d5gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d5gd_ b.78.1.0 (D:) automated matches {Colocasia esculenta [TaxId: 4460]} nipftnnllfsgqvlygdgrltakshqlvmqgdcnlvlyggkygwqsnthgngehcflrl nhkgeliikdddfktiwsssssskhgdyvlilrddgfaviygpaiwetspq
Timeline for d5d5gd_: