Lineage for d5bp5a1 (5bp5 A:9-151)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401897Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2401898Protein automated matches [226913] (9 species)
    not a true protein
  7. 2401921Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries)
  8. 2401938Domain d5bp5a1: 5bp5 A:9-151 [276498]
    Other proteins in same PDB: d5bp5a3, d5bp5b3
    automated match to d4lo0a1
    complexed with ipt

Details for d5bp5a1

PDB Entry: 5bp5 (more details), 2.18 Å

PDB Description: crystal structure of ha17-ha33-ipt
PDB Compounds: (A:) ha-33

SCOPe Domain Sequences for d5bp5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bp5a1 b.42.2.0 (A:9-151) automated matches {Clostridium botulinum [TaxId: 1491]}
nslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihn
tnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlk
lstlnnsnyikfiiedyiisdln

SCOPe Domain Coordinates for d5bp5a1:

Click to download the PDB-style file with coordinates for d5bp5a1.
(The format of our PDB-style files is described here.)

Timeline for d5bp5a1: