![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) ![]() |
![]() | Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein) less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit automatically mapped to Pfam PF06433 this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain |
![]() | Protein Methylamine dehydrogenase, H-chain [50971] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [50972] (5 PDB entries) |
![]() | Domain d2bbkh_: 2bbk H: [27634] Other proteins in same PDB: d2bbkl_, d2bbkm_ missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2bbk (more details), 1.75 Å
SCOPe Domain Sequences for d2bbkh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg
Timeline for d2bbkh_: