PDB entry 2bbk

View 2bbk on RCSB PDB site
Description: crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Class: electron transport
Keywords: electron transport
Deposited on 1993-12-17, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.167
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: methylamine dehydrogenase (heavy subunit)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (0-354)
      • conflict (280-281)
    Domains in SCOPe 2.07: d2bbkh_
  • Chain 'J':
    Compound: methylamine dehydrogenase (heavy subunit)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (0-354)
      • conflict (280-281)
    Domains in SCOPe 2.07: d2bbkj_
  • Chain 'L':
    Compound: methylamine dehydrogenase (light subunit)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (0-124)
      • conflict (50)
    Domains in SCOPe 2.07: d2bbkl_
  • Chain 'M':
    Compound: methylamine dehydrogenase (light subunit)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (0-124)
      • conflict (50)
    Domains in SCOPe 2.07: d2bbkm_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bbkH (H:)
    deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf
    iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl
    lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt
    peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea
    eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh
    eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bbkJ (J:)
    deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf
    iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl
    lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt
    peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea
    eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh
    eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bbkL (L:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bbkM (M:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas