Lineage for d1gof_3 (1gof 151-537)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
consists of seven 4-stranded beta-sheet motifs; meander
Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family) 
Family b.69.1.1: Galactose oxidase, central domain [50966] (1 protein) Protein Galactose oxidase, central domain [50967] (2 species)
N-terminal domain is a jelly-roll sandwich
C-terminal domain is Immunoglobulin-like
Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries) 
Domain d1gof_3: 1gof 151-537 [27631]
Other proteins in same PDB: d1gof_1, d1gof_2
complexed with acy, cu, na
Details for d1gof_3
PDB Entry: 1gof (more details), 1.7 Å
PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase
SCOP Domain Sequences for d1gof_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gof_3 b.69.1.1 (151-537) Galactose oxidase, central domain {Dactylium dendroides}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn
SCOP Domain Coordinates for d1gof_3:
Click to download the PDB-style file with coordinates for d1gof_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gof_3:
- d1gof_3 first appeared (with stable ids) in SCOP 1.55
- d1gof_3 appears in SCOP 1.69
- d1gof_3 is called d1gofa3 in SCOP 1.73
- d1gof_3 appears in the current release, SCOPe 2.08, called d1gofa3
View in 3D
