Lineage for d1gof_3 (1gof 151-537)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469053Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 469054Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family) (S)
  5. 469055Family b.69.1.1: Galactose oxidase, central domain [50966] (1 protein)
  6. 469056Protein Galactose oxidase, central domain [50967] (2 species)
    N-terminal domain is a jelly-roll sandwich
    C-terminal domain is Immunoglobulin-like
  7. 469057Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries)
  8. 469058Domain d1gof_3: 1gof 151-537 [27631]
    Other proteins in same PDB: d1gof_1, d1gof_2

Details for d1gof_3

PDB Entry: 1gof (more details), 1.7 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

SCOP Domain Sequences for d1gof_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gof_3 b.69.1.1 (151-537) Galactose oxidase, central domain {Dactylium dendroides}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOP Domain Coordinates for d1gof_3:

Click to download the PDB-style file with coordinates for d1gof_3.
(The format of our PDB-style files is described here.)

Timeline for d1gof_3: