PDB entry 1gof

View 1gof on RCSB PDB site
Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase
Deposited on 1993-09-30, released 1994-01-31
The last revision prior to the SCOP 1.71 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gof_ (-)
    asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
    ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
    aryvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgptidlpivpaaaaiepts
    grvlmwssyrndafggspggitltsswdpstgivsdrtvtvtkhdmfcpgismdgngqiv
    vtggndakktslydsssdswipgpdmqvargyqssatmsdgrvftiggswsggvfeknge
    vyspssktwtslpnakvnpmltadkqglyrsdnhawlfgwkkgsvfqagpstamnwyyts
    gsgdvksagkrqsnrgvapdamcgnavmydavkgkiltfggspdyqdsdattnahiitlg
    epgtspntvfasnglyfartfhtsvvlpdgstfitggqrrgipfedstpvftpeiyvpeq
    dtfykqnpnsivrvyhsislllpdgrvfngggglcgdcttnhfdaqiftpnylynsngnl
    atrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnnggn
    sysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq