![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.18: Hjc-like [64080] (3 proteins) Pfam PF01870 |
![]() | Protein automated matches [190866] (2 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:273057] [275977] (2 PDB entries) |
![]() | Domain d4tkda_: 4tkd A: [275980] automated match to d2eo0a_ mutant |
PDB Entry: 4tkd (more details), 2.01 Å
SCOPe Domain Sequences for d4tkda_:
Sequence, based on SEQRES records: (download)
>d4tkda_ c.52.1.18 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} savernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrkdgkiyvrr eqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrl veakisr
>d4tkda_ c.52.1.18 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} savernivsrlrdkgfavvrapdpipdiialkngviiliemksrkdgkiyvrreqaegii efarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrlveakisr
Timeline for d4tkda_: