Lineage for d4tkda_ (4tkd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882515Family c.52.1.18: Hjc-like [64080] (3 proteins)
    Pfam PF01870
  6. 2882531Protein automated matches [190866] (2 species)
    not a true protein
  7. 2882532Species Sulfolobus solfataricus [TaxId:273057] [275977] (2 PDB entries)
  8. 2882533Domain d4tkda_: 4tkd A: [275980]
    automated match to d2eo0a_
    mutant

Details for d4tkda_

PDB Entry: 4tkd (more details), 2.01 Å

PDB Description: sulfolobus solfataricus hjc mutants
PDB Compounds: (A:) Holliday junction resolvase Hjc

SCOPe Domain Sequences for d4tkda_:

Sequence, based on SEQRES records: (download)

>d4tkda_ c.52.1.18 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
savernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrkdgkiyvrr
eqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrl
veakisr

Sequence, based on observed residues (ATOM records): (download)

>d4tkda_ c.52.1.18 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
savernivsrlrdkgfavvrapdpipdiialkngviiliemksrkdgkiyvrreqaegii
efarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrlveakisr

SCOPe Domain Coordinates for d4tkda_:

Click to download the PDB-style file with coordinates for d4tkda_.
(The format of our PDB-style files is described here.)

Timeline for d4tkda_: