PDB entry 4tkd

View 4tkd on RCSB PDB site
Description: Sulfolobus solfataricus HJC mutants
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-05-26, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Holliday junction resolvase Hjc
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: hjc, SSO0575, ORF-c21_024
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tkda_
  • Chain 'B':
    Compound: Holliday junction resolvase Hjc
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: hjc, SSO0575, ORF-c21_024
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tkdb_
  • Chain 'C':
    Compound: Holliday junction resolvase Hjc
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: hjc, SSO0575, ORF-c21_024
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tkdc_
  • Chain 'D':
    Compound: Holliday junction resolvase Hjc
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: hjc, SSO0575, ORF-c21_024
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tkdd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tkdA (A:)
    mnakkrkgsavernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrk
    dgkiyvrreqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegl
    dledlvrlveakisrtldnfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tkdA (A:)
    savernivsrlrdkgfavvrapdpipdiialkngviiliemksrkdgkiyvrreqaegii
    efarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrlveakisr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tkdB (B:)
    mnakkrkgsavernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrk
    dgkiyvrreqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegl
    dledlvrlveakisrtldnfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tkdB (B:)
    savernivsrlrdkgfavvrappipdiialkngviiliemksrgkiyvrreqaegiiefa
    rksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrlveakisr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4tkdC (C:)
    mnakkrkgsavernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrk
    dgkiyvrreqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegl
    dledlvrlveakisrtldnfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tkdC (C:)
    savernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrkdgkiyvrr
    eqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadsegldledlvrlve
    akisr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4tkdD (D:)
    mnakkrkgsavernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrk
    dgkiyvrreqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegl
    dledlvrlveakisrtldnfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tkdD (D:)
    gsavernivsrlrdkgfavvrappipdiialkngviiliemksrkdgkiyvrreqaegii
    efarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrlvea