SCOPe 2.06: Domain d5ct3a2: 5ct3 A:126-210

Lineage for d5ct3a2 (5ct3 A:126-210)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries)

8. Domain d5ct3a2: 5ct3 A:126-210 [275892]
   Other proteins in same PDB: d5ct3a1, d5ct3b1
   automated match to d1nk1a2
   complexed with 54o

Details for d5ct3a2

PDB Entry: 5ct3, 2 Å

PDB Description: the structure of the nk1 fragment of hgf/sf complexed with 2fa

PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d5ct3a2:

Sequence; same for both SEQRES and ATOM records:

>d5ct3a2 g.14.1.1 (A:126-210) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcseve

Timeline for d5ct3a2:

• d5ct3a2 first appeared in SCOPe 2.05
  
• d5ct3a2 appears in SCOPe 2.07
  
• d5ct3a2 appears in the current release, SCOPe 2.08