Class g: Small proteins [56992] (100 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein NK1 fragment of hepatocyte growth factor [57457] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries) |
Domain d5ct3a2: 5ct3 A:126-210 [275892] Other proteins in same PDB: d5ct3a1, d5ct3b1 automated match to d1nk1a2 complexed with 54o |
PDB Entry: 5ct3 (more details), 2 Å
SCOPe Domain Sequences for d5ct3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ct3a2 g.14.1.1 (A:126-210) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg gpwcftsnpevryevcdipqcseve
Timeline for d5ct3a2: