Class g: Small proteins [56992] (100 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein NK1 fragment of hepatocyte growth factor [57457] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries) |
Domain d5coeb2: 5coe B:126-209 [275858] Other proteins in same PDB: d5coea1, d5coeb1 automated match to d1nk1a2 complexed with epe |
PDB Entry: 5coe (more details), 2.18 Å
SCOPe Domain Sequences for d5coeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5coeb2 g.14.1.1 (B:126-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg gpwcftsnpevryevcdipqcsev
Timeline for d5coeb2: