SCOPe 2.08: Domain d5coeb2: 5coe B:126-209

Lineage for d5coeb2 (5coe B:126-209)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries)

8. Domain d5coeb2: 5coe B:126-209 [275858]
   Other proteins in same PDB: d5coea1, d5coeb1
   automated match to d1nk1a2
   complexed with epe

Details for d5coeb2

PDB Entry: 5coe, 2.18 Å

PDB Description: the structure of the nk1 fragment of hgf/sf complexed with hepes

PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d5coeb2:

Sequence; same for both SEQRES and ATOM records:

>d5coeb2 g.14.1.1 (B:126-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcsev

Timeline for d5coeb2:

• d5coeb2 first appeared in SCOPe 2.05
  
• d5coeb2 appears in SCOPe 2.07