Lineage for d5c3ka_ (5c3k A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642738Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2642739Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2642740Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2642874Protein automated matches [190700] (1 species)
    not a true protein
  7. 2642875Species Human (Homo sapiens) [TaxId:9606] [187840] (48 PDB entries)
  8. 2642917Domain d5c3ka_: 5c3k A: [275837]
    automated match to d1tfqa_
    complexed with 4xf, zn

Details for d5c3ka_

PDB Entry: 5c3k (more details), 2.02 Å

PDB Description: fragment-based drug discovery targeting inhibitor of apoptosis proteins: compound 4
PDB Compounds: (A:) E3 ubiquitin-protein ligase XIAP

SCOPe Domain Sequences for d5c3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c3ka_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr

SCOPe Domain Coordinates for d5c3ka_:

Click to download the PDB-style file with coordinates for d5c3ka_.
(The format of our PDB-style files is described here.)

Timeline for d5c3ka_: