PDB entry 5c3k

View 5c3k on RCSB PDB site
Description: Fragment-Based Drug Discovery Targeting Inhibitor of Apoptosis Proteins: Compound 4
Class: apoptosis
Keywords: ligase, apoptosis
Deposited on 2015-06-17, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c3ka_
  • Heterogens: ZN, 4XF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5c3kA (A:)
gshmnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcg
ggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr

    Sequence, based on observed residues (ATOM records): (download) 
    >5c3kA (A:)
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr