Lineage for d1ingb_ (1ing B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases [50939] (3 families) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) 
Protein Influenza neuraminidase [50943] (9 species) Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
Uniprot P03472 84-470
Domain d1ingb_: 1ing B: [27572]
complexed with ca, st5
Details for d1ingb_
PDB Entry: 1ing (more details), 2.4 Å
PDB Description: influenza a subtype n2 neuraminidase complexed with aromatic bana109 inhibitor
PDB Compounds: (B:) influenza a subtype n2 neuraminidaseSCOPe Domain Sequences for d1ingb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ingb_ b.68.1.1 (B:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi
SCOPe Domain Coordinates for d1ingb_:
Click to download the PDB-style file with coordinates for d1ingb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ingb_:
- d1ingb_ first appeared (with stable ids) in SCOP 1.55
- d1ingb_ appears in SCOPe 2.07
View in 3D
