PDB entry 1ing

View 1ing on RCSB PDB site
Description: influenza a subtype n2 neuraminidase complexed with aromatic bana109 inhibitor
Class: hydrolase (o-glycosyl)
Keywords: neuraminidase, sialidase, hydrolase, o-glycosyl, hydrolase (o-glycosyl)
Deposited on 1995-07-07, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.163
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: influenza a subtype n2 neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06820 (0-387)
      • conflict (257)
    Domains in SCOPe 2.07: d1inga_
  • Chain 'B':
    Compound: influenza a subtype n2 neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06820 (0-387)
      • conflict (257)
    Domains in SCOPe 2.07: d1ingb_
  • Heterogens: CA, ST5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ingA (A:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
    gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ingB (B:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
    gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi