Lineage for d4uhqa_ (4uhq A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535017Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2535018Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2535170Family d.4.1.0: automated matches [273673] (1 protein)
    not a true family
  6. 2535171Protein automated matches [273674] (2 species)
    not a true protein
  7. 2535174Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273675] (3 PDB entries)
  8. 2535175Domain d4uhqa_: 4uhq A: [275686]
    automated match to d1fr2b_
    complexed with cit, ni

Details for d4uhqa_

PDB Entry: 4uhq (more details), 1.5 Å

PDB Description: crystal structure of the pyocin ap41 dnase
PDB Compounds: (A:) large component of pyocin ap41

SCOPe Domain Sequences for d4uhqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhqa_ d.4.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
epgvatgngqpvtgnwlagasqgdgvpipsqiadqlrgkefkswrdfreqfwmavskdps
alenlspsnryfvsqglapyavpeehlgskekfeihhvvplesggalynidnlvivtpkr
hseihkelklkrk

SCOPe Domain Coordinates for d4uhqa_:

Click to download the PDB-style file with coordinates for d4uhqa_.
(The format of our PDB-style files is described here.)

Timeline for d4uhqa_: