SCOPe 2.08: Domain d4uhqa_: 4uhq A:

Lineage for d4uhqa_ (4uhq A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.0: automated matches [273673] (1 protein)
   not a true family

6. Protein automated matches [273674] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273675] (3 PDB entries)

8. Domain d4uhqa_: 4uhq A: [275686]
   automated match to d1fr2b_
   complexed with cit, ni

Details for d4uhqa_

PDB Entry: 4uhq, 1.5 Å

PDB Description: crystal structure of the pyocin ap41 dnase

PDB Compounds: (A:) large component of pyocin ap41

SCOPe Domain Sequences for d4uhqa_:

Sequence; same for both SEQRES and ATOM records:

>d4uhqa_ d.4.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
epgvatgngqpvtgnwlagasqgdgvpipsqiadqlrgkefkswrdfreqfwmavskdps
alenlspsnryfvsqglapyavpeehlgskekfeihhvvplesggalynidnlvivtpkr
hseihkelklkrk

Timeline for d4uhqa_:

• d4uhqa_ first appeared in SCOPe 2.05
  
• d4uhqa_ appears in SCOPe 2.07