Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d5c9kc1: 5c9k C:1-98 [275590] Other proteins in same PDB: d5c9ka2, d5c9kb2, d5c9kc2, d5c9kd2, d5c9ke2, d5c9kf2, d5c9kg2, d5c9kh2 automated match to d2mkwa_ complexed with act; mutant |
PDB Entry: 5c9k (more details), 1.92 Å
SCOPe Domain Sequences for d5c9kc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c9kc1 b.1.1.1 (C:1-98) automated matches {Human (Homo sapiens) [TaxId: 9606]} nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp drfsgsidsssnsasltisglktedeadyycqsydssn
Timeline for d5c9kc1: