Lineage for d5c9kc1 (5c9k C:1-98)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742583Domain d5c9kc1: 5c9k C:1-98 [275590]
    Other proteins in same PDB: d5c9ka2, d5c9kb2, d5c9kc2, d5c9kd2, d5c9ke2, d5c9kf2, d5c9kg2, d5c9kh2
    automated match to d2mkwa_
    complexed with act; mutant

Details for d5c9kc1

PDB Entry: 5c9k (more details), 1.92 Å

PDB Description: crystal structure of a highly fibrillogenic arg24gly mutant of the recombinant variable domain 6ajl2
PDB Compounds: (C:) amyloid lambda 6 light chain variable region pip

SCOPe Domain Sequences for d5c9kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c9kc1 b.1.1.1 (C:1-98) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssn

SCOPe Domain Coordinates for d5c9kc1:

Click to download the PDB-style file with coordinates for d5c9kc1.
(The format of our PDB-style files is described here.)

Timeline for d5c9kc1: