Lineage for d5c9kc_ (5c9k C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758005Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)
  8. 1758134Domain d5c9kc_: 5c9k C: [275590]
    automated match to d2mkwa_
    complexed with act; mutant

Details for d5c9kc_

PDB Entry: 5c9k (more details), 1.92 Å

PDB Description: crystal structure of a highly fibrillogenic arg24gly mutant of the recombinant variable domain 6ajl2
PDB Compounds: (C:) amyloid lambda 6 light chain variable region pip

SCOPe Domain Sequences for d5c9kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c9kc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

SCOPe Domain Coordinates for d5c9kc_:

Click to download the PDB-style file with coordinates for d5c9kc_.
(The format of our PDB-style files is described here.)

Timeline for d5c9kc_: