SCOPe 2.07: Domain d5bq3c_: 5bq3 C:

Lineage for d5bq3c_ (5bq3 C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (76 species)
   not a true protein

7. Species Actinomyces odontolyticus [TaxId:411466] [275552] (1 PDB entry)

8. Domain d5bq3c_: 5bq3 C: [275555]
   automated match to d1tjya_

Details for d5bq3c_

PDB Entry: 5bq3, 2.6 Å

PDB Description: crystal structure of a sugar abc transporter (actodo_00688) from actinomyces odontolyticus atcc 17982 at 2.60 a resolution

PDB Compounds: (C:) Rhamnose ABC transporter, rhamnose-binding protein

SCOPe Domain Sequences for d5bq3c_:

Sequence; same for both SEQRES and ATOM records:

>d5bq3c_ c.93.1.0 (C:) automated matches {Actinomyces odontolyticus [TaxId: 411466]}
gsydvssqsitfipkqlnnpfsdvmlgggknaageigfaevnvvgpleassssqvsfins
evqagtnvlviaandpdavcpalqdarkagtkvvtfdsdsaadcrdlfinqveskqvait
mldmvsdqiggsgkvailsatanaanqnawikfmedeiasndkykgieivakvygddddt
ksfqeaqgllqahpdlnaivspttvgiaatarylstsdykgkvfltglglpnemrsfvkd
gtvkefalwdpaqlgyvaayagaaldsgaikgevgekftagnlgertigenktvvvgdpv
rfnadnidkydf

Timeline for d5bq3c_:

• d5bq3c_ first appeared in SCOPe 2.05
  
• d5bq3c_ appears in SCOPe 2.06
  
• d5bq3c_ appears in the current release, SCOPe 2.08