![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.90: Transcription factor STAT-4 N-domain [48091] (1 superfamily) multihelical; can be divided into two subdomains |
![]() | Superfamily a.90.1: Transcription factor STAT-4 N-domain [48092] (2 families) ![]() automatically mapped to Pfam PF02865 |
![]() | Family a.90.1.0: automated matches [274641] (1 protein) not a true family |
![]() | Protein automated matches [274642] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [275519] (1 PDB entry) |
![]() | Domain d4ziad1: 4zia D:3-124 [275523] Other proteins in same PDB: d4ziaa2, d4ziab2, d4ziac2, d4ziad2, d4ziae2 automated match to d1bgfa_ complexed with fmt, mg, ni |
PDB Entry: 4zia (more details), 2.7 Å
SCOPe Domain Sequences for d4ziad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ziad1 a.90.1.0 (D:3-124) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qwnqlqqldtryleqlhqlysdsfpmelrqflapwiesqdwayaaskeshatlvfhnllg eidqqysrflqesnvlyqhnlrrikqflqsrylekpmeiarivarclweesrllqtaata aq
Timeline for d4ziad1: