SCOPe 2.07: Domain d4ziac1: 4zia C:3-115

Lineage for d4ziac1 (4zia C:3-115)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.90: Transcription factor STAT-4 N-domain [48091] (1 superfamily)
   multihelical; can be divided into two subdomains

4. Superfamily a.90.1: Transcription factor STAT-4 N-domain [48092] (2 families)
   automatically mapped to Pfam PF02865

5. Family a.90.1.0: automated matches [274641] (1 protein)
   not a true family

6. Protein automated matches [274642] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [275519] (1 PDB entry)

8. Domain d4ziac1: 4zia C:3-115 [275522]
   Other proteins in same PDB: d4ziaa2, d4ziab2, d4ziac2, d4ziad2, d4ziae2
   automated match to d1bgfa_
   complexed with fmt, mg, ni

Details for d4ziac1

PDB Entry: 4zia, 2.7 Å

PDB Description: crystal structure of stat3 n-terminal domain

PDB Compounds: (C:) Signal transducer and activator of transcription 3

SCOPe Domain Sequences for d4ziac1:

Sequence, based on SEQRES records:

>d4ziac1 a.90.1.0 (C:3-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qwnqlqqldtryleqlhqlysdsfpmelrqflapwiesqdwayaaskeshatlvfhnllg
eidqqysrflqesnvlyqhnlrrikqflqsrylekpmeiarivarclweesrl

Sequence, based on observed residues (ATOM records):

>d4ziac1 a.90.1.0 (C:3-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qwnqqlhqlysdsfpmelrqflapwiesqdwayaaskeshatlvfhnllgeidqqysrfl
qesnvlyqhnlrrikqflqsrylekpmeiarivarclweesrl

Timeline for d4ziac1:

• d4ziac1 first appeared in SCOPe 2.05, called d4ziac_
  
• d4ziac1 appears in SCOPe 2.06
  
• d4ziac1 appears in the current release, SCOPe 2.08