Lineage for d2sima_ (2sim A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553917Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1553918Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1553919Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1554119Protein Salmonella sialidase [50941] (1 species)
  7. 1554120Species Salmonella typhimurium, strain lt2 [TaxId:90371] [50942] (5 PDB entries)
  8. 1554124Domain d2sima_: 2sim A: [27545]
    complexed with dan

Details for d2sima_

PDB Entry: 2sim (more details), 1.6 Å

PDB Description: the structures of salmonella typhimurium lt2 neuraminidase and its complex with a transition state analogue at 1.6 angstroms resolution
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d2sima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sima_ b.68.1.1 (A:) Salmonella sialidase {Salmonella typhimurium, strain lt2 [TaxId: 90371]}
tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
angsiefqdlsrhlpviksyn

SCOPe Domain Coordinates for d2sima_:

Click to download the PDB-style file with coordinates for d2sima_.
(The format of our PDB-style files is described here.)

Timeline for d2sima_: