Lineage for d2sima_ (2sim A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases [50939] (3 families) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) Protein Salmonella sialidase [50941] (1 species) Species Salmonella typhimurium, strain lt2 [TaxId:90371] [50942] (5 PDB entries) 
Domain d2sima_: 2sim A: [27545]
complexed with dan
Details for d2sima_
PDB Entry: 2sim (more details), 1.6 Å
PDB Description: the structures of salmonella typhimurium lt2 neuraminidase and its complex with a transition state analogue at 1.6 angstroms resolution
PDB Compounds: (A:) sialidaseSCOPe Domain Sequences for d2sima_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sima_ b.68.1.1 (A:) Salmonella sialidase {Salmonella typhimurium, strain lt2 [TaxId: 90371]}
tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
angsiefqdlsrhlpviksyn
SCOPe Domain Coordinates for d2sima_:
Click to download the PDB-style file with coordinates for d2sima_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2sima_:
- d2sima_ first appeared (with stable ids) in SCOP 1.55, called d2sim__
- d2sima_ appears in SCOPe 2.07
View in 3D