SCOPe 2.06: Domain d4qidb_: 4qid B:

Lineage for d4qidb_ (4qid B:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (16 species)
   not a true protein

7. Species Haloquadratum walsbyi [TaxId:362976] [275383] (5 PDB entries)

8. Domain d4qidb_: 4qid B: [275388]
   automated match to d1cwqa_
   complexed with act, mpg, ret

Details for d4qidb_

PDB Entry: 4qid, 2.57 Å

PDB Description: crystal structure of haloquadratum walsbyi bacteriorhodopsin

PDB Compounds: (B:) Bacteriorhodopsin-I

SCOPe Domain Sequences for d4qidb_:

Sequence; same for both SEQRES and ATOM records:

>d4qidb_ f.13.1.0 (B:) automated matches {Haloquadratum walsbyi [TaxId: 362976]}
egegiwlalgtigmllgmlyfiadgldvqdprqkefyvitilipaiaaasylsmffgfgl
tevslangrvvdvywaryadwlfttplllldigllagasqrdigalvgidafmivtglva
tltkvvvaryafwtistismvfllyylvavfgeavsdadedtrstfnalrniilvtwaiy
pvawlvgteglaltglygetllfmvldlvakvgfgfillrsrai

Timeline for d4qidb_:

• d4qidb_ first appeared in SCOPe 2.05
  
• d4qidb_ appears in SCOPe 2.07
  
• d4qidb_ appears in the current release, SCOPe 2.08