Lineage for d1cwqa_ (1cwq A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252282Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2252283Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2252284Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 2252289Protein Bacteriorhodopsin [56871] (2 species)
    a light-driven proton pump
  7. 2252294Species Halobacterium salinarum [TaxId:2242] [56873] (85 PDB entries)
    Uniprot P02945 17-245
  8. 2252336Domain d1cwqa_: 1cwq A: [43412]
    M intermediate structure (A) superimposed on the ground state structure (B)
    complexed with hex, oct, ret, trd, und

Details for d1cwqa_

PDB Entry: 1cwq (more details), 2.25 Å

PDB Description: m intermediate structure of the wild type bacteriorhodopsin in combination with the ground state structure
PDB Compounds: (A:) bacteriorhodopsin ("m" state intermediate in combination with ground state)

SCOPe Domain Sequences for d1cwqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwqa_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapeps

SCOPe Domain Coordinates for d1cwqa_:

Click to download the PDB-style file with coordinates for d1cwqa_.
(The format of our PDB-style files is described here.)

Timeline for d1cwqa_: