SCOPe 2.08: Domain d1cwqa_: 1cwq A:

Lineage for d1cwqa_ (1cwq A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein Bacteriorhodopsin [56871] (3 species)
   a light-driven proton pump

7. Species Halobacterium salinarum [TaxId:2242] [56873] (118 PDB entries)
   Uniprot P02945 17-245

8. Domain d1cwqa_: 1cwq A: [43412]
   M intermediate structure (A) superimposed on the ground state structure (B)
   complexed with hex, oct, ret, trd, und

Details for d1cwqa_

PDB Entry: 1cwq, 2.25 Å

PDB Description: m intermediate structure of the wild type bacteriorhodopsin in combination with the ground state structure

PDB Compounds: (A:) bacteriorhodopsin ("m" state intermediate in combination with ground state)

SCOPe Domain Sequences for d1cwqa_:

Sequence; same for both SEQRES and ATOM records:

>d1cwqa_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapeps

Timeline for d1cwqa_:

• d1cwqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cwqa_ appears in SCOPe 2.07