Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.0: automated matches [227143] (1 protein) not a true family |
Protein automated matches [226845] (16 species) not a true protein |
Species Haloquadratum walsbyi [TaxId:362976] [275383] (5 PDB entries) |
Domain d4qi1a_: 4qi1 A: [275384] automated match to d1cwqa_ complexed with gol, mpg, ret |
PDB Entry: 4qi1 (more details), 1.85 Å
SCOPe Domain Sequences for d4qi1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qi1a_ f.13.1.0 (A:) automated matches {Haloquadratum walsbyi [TaxId: 362976]} lgvegegiwlalgtigmllgmlyfiadgldvqdprqkefyvitilipaiaaasylsmffg fgltevslangrvvdvywaryadwlfttplllldigllagasqrdigalvgidafmivtg lvatltkvvvaryafwtistismvfllyylvavfgeavsdadedtrstfnalrniilvtw aiypvawlvgteglaltglygetllfmvldlvakvgfgfillrsraim
Timeline for d4qi1a_: