SCOPe 2.06: Domain d4qi1a_: 4qi1 A:

Lineage for d4qi1a_ (4qi1 A:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (16 species)
   not a true protein

7. Species Haloquadratum walsbyi [TaxId:362976] [275383] (5 PDB entries)

8. Domain d4qi1a_: 4qi1 A: [275384]
   automated match to d1cwqa_
   complexed with gol, mpg, ret

Details for d4qi1a_

PDB Entry: 4qi1, 1.85 Å

PDB Description: crystal structure of h. walsbyi bacteriorhodopsin

PDB Compounds: (A:) Bacteriorhodopsin-I

SCOPe Domain Sequences for d4qi1a_:

Sequence; same for both SEQRES and ATOM records:

>d4qi1a_ f.13.1.0 (A:) automated matches {Haloquadratum walsbyi [TaxId: 362976]}
lgvegegiwlalgtigmllgmlyfiadgldvqdprqkefyvitilipaiaaasylsmffg
fgltevslangrvvdvywaryadwlfttplllldigllagasqrdigalvgidafmivtg
lvatltkvvvaryafwtistismvfllyylvavfgeavsdadedtrstfnalrniilvtw
aiypvawlvgteglaltglygetllfmvldlvakvgfgfillrsraim

Timeline for d4qi1a_:

• d4qi1a_ first appeared in SCOPe 2.05
  
• d4qi1a_ appears in SCOPe 2.07
  
• d4qi1a_ appears in the current release, SCOPe 2.08