SCOPe 2.05: Domain d4z8ba_: 4z8b A:

Lineage for d4z8ba_ (4z8b A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (21 species)
   not a true protein

7. Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (3 PDB entries)

8. Domain d4z8ba_: 4z8b A: [275306]
   automated match to d2je9a_
   complexed with ca, gol, mn, so4, xmm; mutant

Details for d4z8ba_

PDB Entry: 4z8b, 1.95 Å

PDB Description: crystal structure of a dgl mutant - h51g h131n

PDB Compounds: (A:) Lectin alpha chain

SCOPe Domain Sequences for d4z8ba_:

Sequence, based on SEQRES records:

>d4z8ba_ b.29.1.1 (A:) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
dtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvgisynsvakrl
savvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsia
denslhfsfnkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvhi
weksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records):

>d4z8ba_ b.29.1.1 (A:) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
dtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvgisynsvakrl
savvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktensl
hfsfnkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvhiweksa
vvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Timeline for d4z8ba_:

• d4z8ba_ is new in SCOPe 2.05-stable
  
• d4z8ba_ appears in SCOPe 2.06
  
• d4z8ba_ appears in the current release, SCOPe 2.08