Lineage for d4z8ba_ (4z8b A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042890Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (3 PDB entries)
  8. 2042899Domain d4z8ba_: 4z8b A: [275306]
    automated match to d2je9a_
    complexed with ca, gol, mn, so4, xmm; mutant

Details for d4z8ba_

PDB Entry: 4z8b (more details), 1.95 Å

PDB Description: crystal structure of a dgl mutant - h51g h131n
PDB Compounds: (A:) Lectin alpha chain

SCOPe Domain Sequences for d4z8ba_:

Sequence, based on SEQRES records: (download)

>d4z8ba_ b.29.1.1 (A:) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
dtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvgisynsvakrl
savvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsia
denslhfsfnkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvhi
weksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d4z8ba_ b.29.1.1 (A:) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
dtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvgisynsvakrl
savvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktensl
hfsfnkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvhiweksa
vvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d4z8ba_:

Click to download the PDB-style file with coordinates for d4z8ba_.
(The format of our PDB-style files is described here.)

Timeline for d4z8ba_: