![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (3 PDB entries) |
![]() | Domain d4z8ba_: 4z8b A: [275306] automated match to d2je9a_ complexed with ca, gol, mn, so4, xmm; mutant |
PDB Entry: 4z8b (more details), 1.95 Å
SCOPe Domain Sequences for d4z8ba_:
Sequence, based on SEQRES records: (download)
>d4z8ba_ b.29.1.1 (A:) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]} dtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvgisynsvakrl savvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsia denslhfsfnkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvhi weksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
>d4z8ba_ b.29.1.1 (A:) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]} dtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvgisynsvakrl savvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktensl hfsfnkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvhiweksa vvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
Timeline for d4z8ba_: