SCOPe 2.06: Domain d4tkpa_: 4tkp A:

Lineage for d4tkpa_ (4tkp A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (7 PDB entries)

8. Domain d4tkpa_: 4tkp A: [275230]
   automated match to d2c2vb_
   complexed with so4, zn

Details for d4tkpa_

PDB Entry: 4tkp, 2.08 Å

PDB Description: complex of ubc13 with the ring domain of the trim5alpha retroviral restriction factor

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4tkpa_:

Sequence, based on SEQRES records:

>d4tkpa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
dvaeqwktneaqaietarawtrlyamnni

Sequence, based on observed residues (ATOM records):

>d4tkpa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpdndvae
qwktneaqaietarawtrlyamnni

Timeline for d4tkpa_:

• d4tkpa_ first appeared in SCOPe 2.05
  
• d4tkpa_ appears in SCOPe 2.07
  
• d4tkpa_ appears in the current release, SCOPe 2.08