Lineage for d4tkpa_ (4tkp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939083Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (23 PDB entries)
  8. 2939089Domain d4tkpa_: 4tkp A: [275230]
    automated match to d2c2vb_
    complexed with so4, zn

Details for d4tkpa_

PDB Entry: 4tkp (more details), 2.08 Å

PDB Description: complex of ubc13 with the ring domain of the trim5alpha retroviral restriction factor
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4tkpa_:

Sequence, based on SEQRES records: (download)

>d4tkpa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
dvaeqwktneaqaietarawtrlyamnni

Sequence, based on observed residues (ATOM records): (download)

>d4tkpa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpdndvae
qwktneaqaietarawtrlyamnni

SCOPe Domain Coordinates for d4tkpa_:

Click to download the PDB-style file with coordinates for d4tkpa_.
(The format of our PDB-style files is described here.)

Timeline for d4tkpa_: