Lineage for d5cj3b_ (5cj3 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942433Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2942498Protein automated matches [190190] (5 species)
    not a true protein
  7. 2942536Species Streptomyces flavoviridis [TaxId:66889] [193979] (2 PDB entries)
  8. 2942538Domain d5cj3b_: 5cj3 B: [275193]
    Other proteins in same PDB: d5cj3a2
    automated match to d4iaga_
    complexed with 52g, cl, cu

Details for d5cj3b_

PDB Entry: 5cj3 (more details), 1.65 Å

PDB Description: crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin
PDB Compounds: (B:) Zbm binding protein

SCOPe Domain Sequences for d5cj3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cj3b_ d.32.1.2 (B:) automated matches {Streptomyces flavoviridis [TaxId: 66889]}
mavllsgvpvlaaldvsttqkfwievlgfteefltedfggvsrdgvelficsvedqvvpd
ntqawlrvrdidalhaewsarvssdyadashpamtairevpwgrefglrdpagnlvhfse
lseaae

SCOPe Domain Coordinates for d5cj3b_:

Click to download the PDB-style file with coordinates for d5cj3b_.
(The format of our PDB-style files is described here.)

Timeline for d5cj3b_: