Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein automated matches [190190] (5 species) not a true protein |
Species Streptomyces flavoviridis [TaxId:66889] [193979] (2 PDB entries) |
Domain d5cj3b_: 5cj3 B: [275193] Other proteins in same PDB: d5cj3a2 automated match to d4iaga_ complexed with 52g, cl, cu |
PDB Entry: 5cj3 (more details), 1.65 Å
SCOPe Domain Sequences for d5cj3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cj3b_ d.32.1.2 (B:) automated matches {Streptomyces flavoviridis [TaxId: 66889]} mavllsgvpvlaaldvsttqkfwievlgfteefltedfggvsrdgvelficsvedqvvpd ntqawlrvrdidalhaewsarvssdyadashpamtairevpwgrefglrdpagnlvhfse lseaae
Timeline for d5cj3b_: