SCOPe 2.08: Domain d5cj3a1: 5cj3 A:1-123

Lineage for d5cj3a1 (5cj3 A:1-123)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein automated matches [190190] (5 species)
   not a true protein

7. Species Streptomyces flavoviridis [TaxId:66889] [193979] (2 PDB entries)

8. Domain d5cj3a1: 5cj3 A:1-123 [275190]
   Other proteins in same PDB: d5cj3a2
   automated match to d4iaga_
   complexed with 52g, cl, cu

Details for d5cj3a1

PDB Entry: 5cj3, 1.65 Å

PDB Description: crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin

PDB Compounds: (A:) Zbm binding protein

SCOPe Domain Sequences for d5cj3a1:

Sequence; same for both SEQRES and ATOM records:

>d5cj3a1 d.32.1.2 (A:1-123) automated matches {Streptomyces flavoviridis [TaxId: 66889]}
mavllsgvpvlaaldvsttqkfwievlgfteefltedfggvsrdgvelficsvedqvvpd
ntqawlrvrdidalhaewsarvssdyadashpamtairevpwgrefglrdpagnlvhfse
lse

Timeline for d5cj3a1:

• d5cj3a1 first appeared in SCOPe 2.05, called d5cj3a_
  
• d5cj3a1 appears in SCOPe 2.07