SCOPe 2.07: Domain d4ywgm1: 4ywg M:1-107

Lineage for d4ywgm1 (4ywg M:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4ywgm1: 4ywg M:1-107 [275121]
   automated match to d1dqdl1
   complexed with nag

Details for d4ywgm1

PDB Entry: 4ywg, 3 Å

PDB Description: crystal structure of 830a in complex with v1v2

PDB Compounds: (M:) Light chain of anti-HIV-1 gp120 V1V2 antibody 830A

SCOPe Domain Sequences for d4ywgm1:

Sequence; same for both SEQRES and ATOM records:

>d4ywgm1 b.1.1.0 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dtvmtqspatlsvspgervtlscrasqiintnlawyqkrpgqaprlliyaasaratgipa
rfsgsgsgteftltisglqsedsavyycqqykhwppytfgrgtkleir

Timeline for d4ywgm1:

• d4ywgm1 first appeared in SCOPe 2.05
  
• d4ywgm1 appears in SCOPe 2.06
  
• d4ywgm1 appears in the current release, SCOPe 2.08