Lineage for d1lopa_ (1lop A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232982Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 232983Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 232984Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 232985Protein Bacterial cyclophilin [50901] (1 species)
  7. 232986Species Escherichia coli [TaxId:562] [50902] (3 PDB entries)
  8. 232987Domain d1lopa_: 1lop A: [27510]
    complexed with nit, sin

Details for d1lopa_

PDB Entry: 1lop (more details), 1.8 Å

PDB Description: cyclophilin a complexed with succinyl-ala-pro-ala-p-nitroanilide

SCOP Domain Sequences for d1lopa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lopa_ b.62.1.1 (A:) Bacterial cyclophilin {Escherichia coli}
mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk
qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy
cvfaevvdgmdevdkikgvatgrsgmhqdvpkedviiesvtvse

SCOP Domain Coordinates for d1lopa_:

Click to download the PDB-style file with coordinates for d1lopa_.
(The format of our PDB-style files is described here.)

Timeline for d1lopa_: