SCOPe 2.06: Domain d4wwib_: 4wwi B:

Lineage for d4wwib_ (4wwi B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein Immunoglobulin-binding protein A modules [46999] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [47000] (20 PDB entries)

8. Domain d4wwib_: 4wwi B: [275001]
   Other proteins in same PDB: d4wwid1, d4wwid2, d4wwie1, d4wwif1, d4wwif2
   automated match to d4npda_

Details for d4wwib_

PDB Entry: 4wwi, 2.31 Å

PDB Description: crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution

PDB Compounds: (B:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4wwib_:

Sequence; same for both SEQRES and ATOM records:

>d4wwib_ a.8.1.1 (B:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
nkfnkeqqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqapk

Timeline for d4wwib_:

• d4wwib_ first appeared in SCOPe 2.05
  
• d4wwib_ appears in SCOPe 2.07
  
• d4wwib_ appears in the current release, SCOPe 2.08