Lineage for d4wwib_ (4wwi B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2696964Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2696965Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 2696966Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries)
  8. 2696980Domain d4wwib_: 4wwi B: [275001]
    Other proteins in same PDB: d4wwid1, d4wwid2, d4wwie1, d4wwie2, d4wwif1, d4wwif2
    automated match to d4npda_

Details for d4wwib_

PDB Entry: 4wwi (more details), 2.31 Å

PDB Description: crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution
PDB Compounds: (B:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4wwib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wwib_ a.8.1.1 (B:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
nkfnkeqqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqapk

SCOPe Domain Coordinates for d4wwib_:

Click to download the PDB-style file with coordinates for d4wwib_.
(The format of our PDB-style files is described here.)

Timeline for d4wwib_: