SCOP 1.71: Domain d2rmce_: 2rmc E:

Lineage for d2rmce_ (2rmc E:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (2 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (10 species)

7. Species Mouse (Mus musculus), variant C [TaxId:10090] [50897] (1 PDB entry)

8. Domain d2rmce_: 2rmc E: [27493]

Details for d2rmce_

PDB Entry: 2rmc, 1.64 Å

PDB Description: crystal structure of murine cyclophilin c complexed with immunosuppressive drug cyclosporin a

SCOP Domain Sequences for d2rmce_:

Sequence; same for both SEQRES and ATOM records:

>d2rmce_ b.62.1.1 (E:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C}
krgpsvtdkvffdvrigdkdvgriviglfgnvvpktvenfvalatgekgygykgsifhrv
ikdfmiqggdftardgtggmsiygetfpdenfklkhygigwvsmanagpdtngsqffitl
tkptwldgkhvvfgkvldgmtvvhsielqatdghdrpltdctivnsgkidvktpfvvevp
dw

Timeline for d2rmce_:

• d2rmce_ first appeared (with stable ids) in SCOP 1.55
  
• d2rmce_ appears in SCOP 1.69
  
• d2rmce_ appears in SCOP 1.73
  
• d2rmce_ appears in the current release, SCOPe 2.08