Lineage for d2rmce_ (2rmc E:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468514Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 468515Superfamily b.62.1: Cyclophilin-like [50891] (2 families) (S)
  5. 468516Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 468527Protein Cyclophilin (eukaryotic) [50893] (9 species)
  7. 468633Species Mouse (Mus musculus), variant C [TaxId:10090] [50897] (1 PDB entry)
  8. 468636Domain d2rmce_: 2rmc E: [27493]

Details for d2rmce_

PDB Entry: 2rmc (more details), 1.64 Å

PDB Description: crystal structure of murine cyclophilin c complexed with immunosuppressive drug cyclosporin a

SCOP Domain Sequences for d2rmce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmce_ b.62.1.1 (E:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C}
krgpsvtdkvffdvrigdkdvgriviglfgnvvpktvenfvalatgekgygykgsifhrv
ikdfmiqggdftardgtggmsiygetfpdenfklkhygigwvsmanagpdtngsqffitl
tkptwldgkhvvfgkvldgmtvvhsielqatdghdrpltdctivnsgkidvktpfvvevp
dw

SCOP Domain Coordinates for d2rmce_:

Click to download the PDB-style file with coordinates for d2rmce_.
(The format of our PDB-style files is described here.)

Timeline for d2rmce_: