Lineage for d1awtc_ (1awt C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325683Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1325684Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1325685Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1325686Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1325701Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (58 PDB entries)
    Uniprot P05092
  8. 1325796Domain d1awtc_: 1awt C: [27483]

Details for d1awtc_

PDB Entry: 1awt (more details), 2.55 Å

PDB Description: secypa complexed with hagpia
PDB Compounds: (C:) cyclophilin a

SCOPe Domain Sequences for d1awtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awtc_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1awtc_:

Click to download the PDB-style file with coordinates for d1awtc_.
(The format of our PDB-style files is described here.)

Timeline for d1awtc_: