SCOPe 2.08: Domain d4ttdd2: 4ttd D:109-211

Lineage for d4ttdd2 (4ttd D:109-211)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d4ttdd2: 4ttd D:109-211 [274779]
Other proteins in same PDB: d4ttda_, d4ttdb_, d4ttdc_, d4ttdd1, d4ttdh_, d4ttdl1
automated match to d2fb4l2

Details for d4ttdd2

PDB Entry: 4ttd (more details), 2.15 Å

PDB Description: structure of a lysozyme antibody complex

PDB Compounds: (D:) Fab light chain

SCOPe Domain Sequences for d4ttdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ttdd2 b.1.1.2 (D:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d4ttdd2:

Click to download the PDB-style file with coordinates for d4ttdd2.
(The format of our PDB-style files is described here.)

Timeline for d4ttdd2: