![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1138 PDB entries) |
![]() | Domain d4ttdd2: 4ttd D:109-211 [274779] Other proteins in same PDB: d4ttda_, d4ttdb_, d4ttdd1, d4ttdl1 automated match to d2fb4l2 |
PDB Entry: 4ttd (more details), 2.15 Å
SCOPe Domain Sequences for d4ttdd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttdd2 b.1.1.2 (D:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d4ttdd2:
![]() Domains from other chains: (mouse over for more information) d4ttda_, d4ttdb_, d4ttdl1, d4ttdl2 |